Recombinant Dog 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase (HSD3B)

Shipped with Ice Packs
In Stock

Description

Overview of 3β-Hydroxysteroid Dehydrogenase/Δ5-4 Isomerase (3β-HSD)

3β-Hydroxysteroid dehydrogenase/Δ5-4 isomerase (3β-HSD), also known as 3β-HSD (EC 1.1.1.145), is a crucial enzyme involved in the synthesis of steroid hormones . Specifically, it catalyzes the conversion of Δ5-3β-hydroxysteroids to Δ4-3-ketosteroids, which is essential for producing progesterone, glucocorticoids, mineralocorticoids, androgens, and estrogens . In dogs, as in other mammals, 3β-HSD plays a vital role in the formation of bioactive steroid hormones .

Function and Mechanism

3β-HSD functions as a complex that facilitates several key conversions in steroidogenesis :

  • Pregnenolone to progesterone

  • 17α-Hydroxypregnenolone to 17α-hydroxyprogesterone

  • Dehydroepiandrosterone (DHEA) to androstenedione

  • Androstenediol to testosterone

  • Androstadienol to androstadienone

This enzyme is essential in tissues that produce steroids, such as the adrenal glands, ovaries, testes, and placenta .

Gene Structure and Expression

The 3β-HSD enzyme is encoded by the HSD3B gene . In humans, two isoforms, HSD3B1 and HSD3B2, are known . Canine ovarian 3β-HSD has been cloned and characterized, revealing that the transcript includes a 5'-untranslated region (UTR) of 126 nucleotides, an open reading frame (ORF) of 1122 nucleotides, and a 3'-UTR of 441 nucleotides . The ORF encodes a protein of 374 amino acids, which shows high sequence conservation (79-85% identity) across different species .

Expression in Canine Corpora Lutea

Studies have investigated the expression of 3β-HSD in canine corpora lutea (CL) during different stages: formation, early regression, and late regression . Research indicates that 3β-HSD is expressed throughout these stages, with the highest expression levels observed during the early stages (days 5 and 15 after ovulation) . As the diestrus progresses, the expression of 3β-HSD significantly decreases, suggesting that the availability of this enzyme controls progesterone production .

Inhibition of 3β-HSD

Inhibiting 3β-HSD can be a method for terminating unwanted pregnancies in dogs by interfering with progesterone synthesis . Trilostane, a competitive inhibitor of 3β-HSD, has been shown to effectively decrease plasma progesterone concentrations in bitches during the luteal phase . Studies administering trilostane orally to non-pregnant bitches demonstrated a significant reduction in plasma progesterone levels without apparent side effects .

Relevance to Canine Health

The activity of 3β-HSD is vital for maintaining progesterone levels, which are crucial for pregnancy maintenance in dogs . Dysregulation or inhibition of this enzyme can lead to decreased progesterone synthesis, potentially affecting fertility and pregnancy outcomes . Further research into 3β-HSD may provide insights into managing reproductive health and developing treatments for hormone-related conditions in canines.

Data Table: Characteristics of Canine 3β-HSD

CharacteristicDescription
GeneHSD3B
Amino Acid Length374
Sequence Conservation79-85% identity between species
ExpressionHighest on days 5 and 15 post-ovulation in canine CL, decreasing towards the end of diestrus
ActivityCatalyzes the conversion of pregnenolone to progesterone, DHEA to androstenedione, and other key steps in steroid hormone synthesis
InhibitionCan be inhibited by drugs like trilostane, leading to decreased progesterone levels

Future Directions

Continued research on canine 3β-HSD is essential for a deeper understanding of its regulation, function, and potential therapeutic applications. Areas for further investigation include:

  • Detailed analysis of the factors regulating HSD3B gene expression in different canine tissues

  • Exploration of the potential of 3β-HSD inhibitors for managing hormone-related disorders in dogs

  • Investigation into the role of insulin and glucose uptake in canine luteal cells and their relationship with 3β-HSD activity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on order type and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSD3B; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase; 3-beta-HSD [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
HSD3B
Target Protein Sequence
AGWSCLVTGAGGFLGQRIVHLLAEEKELQEIRALDKAFRPELLEEFSKLQSKTKLTMVEG DILDEQCLKRACQGTSVVIHTASVIDVMNVIHRETIMNVNLKGTQLLLEACAQASVPIFI YTSTIEVAGPNSYRDIIQNAHEEEHLESTWSAPYPYSKKLAEKAVLAANGWALKNGGTLH TCALRPMYIYGEGSIFLYNYIYKALRNNGILTHHSKFSIVNPVYVGNVAWAHILALRALQ DPKKAPSVQGQFYYISDDTPHQSYDDLNYNLSKEWGFSLDSRMSLPISLEYWLAFLLEIV SFLLSPIYKYQPPFNRHMVTLSNSIFTFSYKKAQRDLGYKPLFSWEEAKQKTTEWIGSLV KQHKETLKTKTH
Uniprot No.

Target Background

Function

3β-HSD is a bifunctional enzyme catalyzing the oxidative conversion of Δ⁵-ene-3β-hydroxy steroids and ketosteroids. The 3β-HSD enzymatic system plays a crucial role in the biosynthesis of all hormonal steroid classes.

Gene References Into Functions
  1. This study investigated the effects of long-term, low-dose zearalenone exposure on the expression of 3β-hydroxysteroid dehydrogenase (3β-HSD) and 17β-hydroxysteroid dehydrogenase (17β-HSD) in the ovaries of pre-pubertal bitches. PMID: 23691576
Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is the biological function of canine 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase (HSD3B)?

Canine 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase (HSD3B) is a key enzyme in the biosynthetic pathway of steroid hormones. It catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxy steroid precursors into delta-4-3-keto steroids, which is an essential step in the production of progesterone, corticosteroids, and androgens. In dogs specifically, HSD3B plays a crucial role in progesterone synthesis, which is the primary hormone responsible for maintaining pregnancy. Research has confirmed that progesterone (P4) is the only hormone needed to maintain pregnancy in dogs . The enzyme exhibits high sequence conservation across mammalian species (79-85% identity), indicating its evolutionary importance .

How can recombinant canine HSD3B be used to study reproductive pharmacology?

Recombinant canine HSD3B provides a valuable tool for studying reproductive pharmacology, particularly for screening potential inhibitors that could modulate progesterone synthesis. Studies have investigated trilostane, a competitive inhibitor of 3β-HSD, for its efficacy in terminating mid-term pregnancies in dogs by inhibiting progesterone synthesis .

When using recombinant HSD3B for inhibitor screening, researchers should establish a stable enzyme activity assay measuring the conversion of pregnenolone to progesterone. The methodological approach involves:

  • Expression and purification of recombinant canine HSD3B with high purity (>90% as determined by SDS-PAGE)

  • Establishment of optimal enzyme reaction conditions (buffer composition, pH, temperature)

  • Determination of enzyme kinetics (Km, Vmax) for substrate

  • Screening of potential inhibitors at various concentrations to determine IC50 values

  • Validation of promising compounds in canine cell-based systems

This approach allows for precise determination of structure-activity relationships and comparative analysis of inhibitor potency across species.

What experimental approaches can be used to study post-translational modifications of canine HSD3B?

Post-translational modifications (PTMs) of canine HSD3B can significantly affect its activity, stability, and cellular localization. Several experimental approaches can be employed to identify and characterize these modifications:

  • Mass Spectrometry Analysis:

    • Tryptic digestion of purified recombinant HSD3B followed by LC-MS/MS

    • Targeted analysis for common modifications (phosphorylation, glycosylation)

    • Comparison of modifications between recombinant and native canine HSD3B

  • Site-Directed Mutagenesis:

    • Generation of mutants at predicted PTM sites

    • Functional analysis of enzyme activity in mutant proteins

    • Analysis of protein stability and subcellular localization

  • Phosphorylation-Specific Techniques:

    • Phospho-specific antibodies (if available)

    • Phosphatase treatment experiments

    • Kinase inhibitor studies in cellular systems

  • In Vivo Labeling Studies:

    • Metabolic labeling of canine luteal cells with radioactive phosphate

    • Immunoprecipitation of HSD3B followed by autoradiography

    • Comparison of modification patterns at different luteal stages

These approaches would help elucidate the regulatory mechanisms affecting HSD3B function during different physiological states in dogs.

What is the optimal expression system for producing functional recombinant canine HSD3B?

The choice of expression system significantly impacts the functionality and yield of recombinant canine HSD3B. Based on the available research:

  • Bacterial Expression (E. coli):

    • Successfully used to produce His-tagged recombinant canine HSD3B

    • Advantages: High yield, cost-effective, simple scale-up

    • Limitations: Lack of eukaryotic post-translational modifications, potential improper folding

    • Optimization strategies: Lower induction temperature (16-20°C), use of specialized E. coli strains (BL21-CodonPlus, Rosetta)

  • Mammalian Expression Systems:

    • HEK293T cells have been used to express and functionally characterize canine 3betaHSD

    • Advantages: Proper folding, post-translational modifications

    • Limitations: Lower yield, higher cost

    • Applications: Ideal for functional studies, particularly when examining enzymatic activity

  • Storage and Stability Considerations:

    • Recommended storage in Tris/PBS-based buffer, pH 8.0 with 6% trehalose

    • Avoid repeated freeze-thaw cycles

    • For long-term storage, add glycerol (final concentration 5-50%, with 50% being optimal) and store at -20°C/-80°C

For functional enzyme studies, the heterologous mammalian expression system appears to be superior as it has been demonstrated to preserve the specific 3betaHSD activity without any detectable 17-hydroxysteroid dehydrogenase activity .

How can enzymatic activity of recombinant canine HSD3B be accurately measured?

Accurate measurement of canine HSD3B enzymatic activity is essential for functional characterization. The recommended methodological approaches include:

  • Spectrophotometric NAD+/NADH Conversion Assay:

    • Principle: Monitoring the increase in absorbance at 340 nm due to NADH production

    • Reaction mixture: Pregnenolone (substrate), NAD+ (cofactor), recombinant HSD3B, appropriate buffer

    • Controls: No enzyme, heat-inactivated enzyme, known inhibitor (e.g., trilostane)

  • Radiometric Assay:

    • Principle: Conversion of radiolabeled substrate to product

    • Methodology: Incubation of enzyme with [³H]-pregnenolone, extraction of steroids, and separation by thin-layer chromatography

    • Quantification: Scintillation counting of substrate and product spots

  • LC-MS/MS Method:

    • Principle: Direct quantification of pregnenolone and progesterone

    • Advantages: High specificity, no radioactivity, multiple analytes simultaneously

    • Sample preparation: Liquid-liquid extraction or solid-phase extraction

  • Cell-Based Functional Assays:

    • Transfection of HEK293T cells with canine HSD3B expression vector

    • Measurement of progesterone production after pregnenolone addition

    • This approach has confirmed the absence of 17-hydroxysteroid dehydrogenase activity in canine HSD3B

When interpreting activity data, researchers should consider factors such as substrate concentration, enzyme purity, and the presence of potential interfering compounds.

How does canine HSD3B compare functionally with the enzyme from other species?

Comparative analysis of HSD3B across species provides valuable insights into evolutionary conservation and species-specific functional adaptations:

  • Sequence Conservation:

    • Canine HSD3B shows 79-85% amino acid sequence identity with other species

    • The catalytic domains and cofactor binding sites show the highest conservation

  • Functional Differences:

    • Unlike some mammalian species with multiple HSD3B isoforms, studies suggest dogs may primarily express one predominant isoform in reproductive tissues

    • The canine enzyme has been specifically confirmed to possess 3betaHSD activity without detectable 17-hydroxysteroid dehydrogenase activity

  • Comparative Inhibitor Sensitivity:

    • Trilostane is a competitive inhibitor of 3β-HSD across species

    • In dogs, trilostane treatment decreases progesterone levels, but a seven-day treatment alone was found insufficient to terminate mid-term pregnancies despite lowering progesterone concentrations

    • This suggests potential species-specific differences in the threshold progesterone levels required for pregnancy maintenance

  • Physiological Context:

    • In dogs, progesterone is the sole hormone required to maintain pregnancy , which may explain the particular importance of HSD3B in canine reproductive physiology

    • The strong expression of HSD3B in early and mid-luteal phases (days 5 and 15 post-ovulation) in dogs reflects its critical role in maintaining luteal function

These comparative insights are particularly valuable when translating findings across species or when developing species-specific therapeutic approaches.

How do inhibitors of canine HSD3B affect progesterone synthesis and pregnancy?

Inhibition of canine HSD3B and its effects on progesterone synthesis and pregnancy have been studied in detail, providing valuable insights for reproductive research:

  • Effects of Trilostane (3β-HSD Inhibitor) on Progesterone Levels:

    • Administration of trilostane to pregnant dogs produced a marked decrease in progesterone concentrations at 6, 54, and 102 hours after treatment initiation

    • This confirms the mechanism of action via inhibition of progesterone synthesis

  • Relationship Between Progesterone Suppression and Pregnancy Termination:

    • Despite decreasing progesterone levels, a seven-day trilostane treatment alone was not effective in terminating mid-term pregnancies in dogs (0% termination rate)

    • In comparison, aglepristone (a progesterone receptor antagonist) achieved 100% pregnancy termination

  • Effects on Fetal Parameters:

    • Fetal heart rates (FHRs) decreased in both trilostane and aglepristone treatment groups compared to control

    • This suggests partial biological effects on fetal viability despite the lack of complete pregnancy termination

  • Implications for Molecular Mechanisms:

    • The luteal expression of StAR (Steroidogenic Acute Regulatory protein) appeared weaker in aglepristone-treated dogs compared to controls

    • This suggests multiple regulatory mechanisms in the steroidogenic pathway beyond just enzyme inhibition

This data indicates that while inhibition of HSD3B successfully reduces progesterone synthesis, additional factors may influence pregnancy maintenance in dogs, highlighting the complexity of reproductive endocrinology in this species.

What are the emerging applications of recombinant canine HSD3B in reproductive medicine research?

Several emerging research directions are expanding the applications of recombinant canine HSD3B:

  • Development of Novel Contraceptive Approaches:

    • Research suggests that targeting HSD3B may offer new contraceptive strategies for companion animals

    • Studies are exploring optimal dosing regimens and combination therapies with other reproductive modulators

    • For example, while trilostane alone was insufficient for pregnancy termination, research indicates that "further studies are needed on the effects of the prolonged administration of TRL with varying doses and frequencies for the termination of mid-term pregnancy in dogs"

  • Precision Medicine for Reproductive Disorders:

    • Recombinant HSD3B enables screening for compounds that could treat specific reproductive disorders

    • Potential applications in treating conditions like pyometra, false pregnancy, and progesterone-dependent disorders

  • Comparative Reproductive Endocrinology:

    • Using recombinant enzymes from different species to understand evolutionary adaptations in steroid metabolism

    • Investigating why progesterone alone is sufficient for pregnancy maintenance in dogs but not in all mammals

  • Structure-Based Drug Design:

    • The availability of recombinant protein facilitates structural studies using X-ray crystallography or cryo-EM

    • These structures could enable the design of species-specific inhibitors with improved efficacy and reduced off-target effects

  • Biomarker Development:

    • Research into HSD3B regulation could identify novel biomarkers for reproductive status and disorders

    • Potential applications in monitoring corpus luteum function in breeding management

These emerging applications highlight the continuing importance of recombinant canine HSD3B as a research tool in veterinary reproductive medicine.

How might studying canine HSD3B contribute to understanding reproductive disorders across species?

Research on canine HSD3B has broader implications for comparative reproductive biology and translational medicine:

  • Unique Features of Canine Reproduction:

    • Dogs represent a unique reproductive model where progesterone is the sole hormone necessary for pregnancy maintenance

    • Studying the regulation of canine HSD3B provides insights into luteal progesterone production that may be applicable to other species

  • Comparative Pathway Analysis:

    • The steroidogenic pathway involving HSD3B is conserved across mammals but with species-specific variations

    • Comparing regulatory mechanisms between species can identify both conserved and divergent control points

  • One Health Applications:

    • Reproductive disorders with similar steroidogenic disruptions occur in multiple species

    • Knowledge gained from canine studies might inform research on conditions such as:

      • Luteal phase defects in women

      • Reproductive aging across mammals

      • Environmental endocrine disruptor effects on steroidogenesis

  • Evolutionary Insights:

    • The high conservation of HSD3B (79-85% identity between species) suggests evolutionary constraints on this enzyme

    • Understanding species-specific variations might reveal adaptive mechanisms in reproductive physiology

  • Translational Research Opportunities:

    • The observed effects of HSD3B inhibition in dogs provide a model for investigating the minimum progesterone threshold required for pregnancy maintenance

    • This knowledge could inform approaches to treating progesterone-dependent disorders in various species

The study of canine HSD3B thus serves as an important component of the broader understanding of mammalian reproductive endocrinology and steroid metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.